- RAB3GAP2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84198
- Immunohistochemistry, Immunohistochemistry-Paraffin
- MARTS1, RAB3-GAP150, RAB3GAP150, SPG69, WARBM2, p150
- Human
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: EHHSILCSIL YAVMRFSLKT VKPLSLFDSK GKNAFFKDLT SIQLLPSGEM DPNFISVRQQ FLLKVVSAAV QAQHSATKVK DPT
- 0.1 ml (also 25ul)
- Rabbit
- RAB3GAP2
- PBS (pH 7.2) and 40% Glycerol
- RAB3 GTPase activating non-catalytic protein subunit 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Cell Biology, GPCR, Neuroscience, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
EHHSILCSILYAVMRFSLKTVKPLSLFDSKGKNAFFKDLTSIQLLPSGEMDPNFISVRQQFLLKVVSAAVQAQHSATKVKDPT
Specifications/Features
Available conjugates: Unconjugated